PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.009G170550.1.p
Common NameSb09g023170, SORBIDRAFT_09g023170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family FAR1
Protein Properties Length: 665aa    MW: 77981 Da    PI: 9.4432
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.009G170550.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR134.37.5e-114435090
                  FAR1 50 kerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                          k+r+t+  ++t+C++ +++k++  + w++++l+l+HnHel 
  Sobic.009G170550.1.p  4 KKRKTNIAEKTDCQCVMVIKED-ANIWKIIRLDLDHNHELY 43
                          7899****************99.9***************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.5E-8344IPR004330FAR1 DNA binding domain
PfamPF105511.7E-36164257IPR018289MULE transposase domain
PROSITE profilePS509669.903449487IPR007527Zinc finger, SWIM-type
SMARTSM005756.2E-6462489IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MKGKKRKTNI AEKTDCQCVM VIKEDANIWK IIRLDLDHNH ELYPGQSNQQ FSGHKYMTDM  60
EKSLIRTLND NNIATRQMIS IISYLRGGPT ALPVKKKDIS NFRTKINREI KGTDMTKVLD  120
NFRKKKSEDP TFFYKFELDD ENRMKNIFWR DGSSLKYYAD FGDCVSFDTT YMTNRYRLPF  180
APFVGITGHA QTCIFGCAFL KDETIATFKW LFETFLESMG GKHPQTIITD QDKAMKTAIE  240
EVMPNTRHRN CLFHIKTKCY SKNIKVFAAN DGLYEEFEDI VNNSVTEEEF ENLWREMIRE  300
RGLENNKYLT KMWETRKRFI PVYYKNDFFP FIQSTSRSEA TNARFKQNVG PTYSINSFVA  360
EYDRIVDSIE RAENLEDHYS NQKRPKELLY GYTFEKQAQE LYNRNIYKKF QIQLQATSTL  420
TYKEIEEGKQ FEVWQRSNQV YKAQRIRRYI VLTNLTQGNE DFSCICAKFS KDGILCSHIL  480
KIMIEKEISA IPDKYIIDRW RKKDMRLIRK RVEETTIATN SLLRFNVLSR KSAAMNSKAA  540
KTEEATDYLV AEMERINLHL DKLLAPKSIG ETQSEPIADE QVQTQGLKAY EDNYTQNQLE  600
DPERIQNKGR PEKPKRMKAV IEEAKEKAKK KENKKKKKQT TNENSGTIYN SNSISLLTYC  660
NLNI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1500510RKKDMRLIRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439945.10.0hypothetical protein SORBIDRAFT_09g023170
TrEMBLC5YZP70.0C5YZP7_SORBI; Putative uncharacterized protein Sb09g023170
STRINGSb09g023170.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.15e-88FAR1-related sequence 5